Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (17 species) |
Species Thermus caldophilus [TaxId:272] [226614] (2 PDB entries) |
Domain d3vphb1: 3vph B:21-162 [218005] Other proteins in same PDB: d3vpha2, d3vphb2, d3vphc2, d3vphd2 automated match to d1llda1 complexed with fbp, gol, nad, oxm |
PDB Entry: 3vph (more details), 2 Å
SCOPe Domain Sequences for d3vphb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vphb1 c.2.1.5 (B:21-162) Lactate dehydrogenase {Thermus caldophilus [TaxId: 272]} mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd vmtqvayrlsalppgrvvgsg
Timeline for d3vphb1: