SCOPe 2.05: Domain d3vpha1: 3vph A:21-162

Lineage for d3vpha1 (3vph A:21-162)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (17 species)

7. Species Thermus caldophilus [TaxId:272] [226614] (2 PDB entries)

8. Domain d3vpha1: 3vph A:21-162 [218003]
   Other proteins in same PDB: d3vpha2, d3vphb2, d3vphc2, d3vphd2
   automated match to d1llda1
   complexed with fbp, gol, nad, oxm

Details for d3vpha1

PDB Entry: 3vph, 2 Å

PDB Description: l-lactate dehydrogenase from thermus caldophilus gk24 complexed with oxamate, nadh and fbp

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3vpha1:

Sequence; same for both SEQRES and ATOM records:

>d3vpha1 c.2.1.5 (A:21-162) Lactate dehydrogenase {Thermus caldophilus [TaxId: 272]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsalppgrvvgsg

Timeline for d3vpha1:

• d3vpha1 first appeared in SCOPe 2.03
  
• d3vpha1 appears in SCOPe 2.04
  
• d3vpha1 appears in SCOPe 2.06
  
• d3vpha1 appears in the current release, SCOPe 2.08