| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Lactate dehydrogenase [51859] (19 species) |
| Species Thermus caldophilus [TaxId:272] [226614] (2 PDB entries) |
| Domain d3vpgc1: 3vpg C:21-162 [217999] Other proteins in same PDB: d3vpga2, d3vpgb2, d3vpgc2, d3vpgd2 automated match to d1llda1 complexed with gol |
PDB Entry: 3vpg (more details), 1.8 Å
SCOPe Domain Sequences for d3vpgc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vpgc1 c.2.1.5 (C:21-162) Lactate dehydrogenase {Thermus caldophilus [TaxId: 272]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsalppgrvvgsg
Timeline for d3vpgc1: