Lineage for d3vpff1 (3vpf F:3-150)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1829377Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1829416Protein Lactate dehydrogenase [51859] (17 species)
  7. 1829532Species Lactobacillus casei [TaxId:1582] [51865] (6 PDB entries)
  8. 1829554Domain d3vpff1: 3vpf F:3-150 [217993]
    Other proteins in same PDB: d3vpfa2, d3vpfb2, d3vpfc2, d3vpfd2, d3vpfe2, d3vpff2
    automated match to d1llca1
    complexed with pyr, so4; mutant

Details for d3vpff1

PDB Entry: 3vpf (more details), 2.79 Å

PDB Description: complex structure of lactobacillus casei lactate dehydrogenase penta mutant with pyruvate
PDB Compounds: (F:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3vpff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vpff1 c.2.1.5 (F:3-150) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
sitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpfts
pkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngifl
vaanpvdiltyatwklsgfpknrvvgsg

SCOPe Domain Coordinates for d3vpff1:

Click to download the PDB-style file with coordinates for d3vpff1.
(The format of our PDB-style files is described here.)

Timeline for d3vpff1: