Lineage for d3vpfe2 (3vpf E:151-318)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2604674Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2604681Protein Lactate dehydrogenase [56339] (20 species)
  7. 2604955Species Lactobacillus casei [TaxId:1582] [56345] (7 PDB entries)
  8. 2604976Domain d3vpfe2: 3vpf E:151-318 [217992]
    Other proteins in same PDB: d3vpfa1, d3vpfb1, d3vpfc1, d3vpfd1, d3vpfe1, d3vpff1
    automated match to d1llca2
    complexed with pyr, so4; mutant

Details for d3vpfe2

PDB Entry: 3vpf (more details), 2.79 Å

PDB Description: complex structure of lactobacillus casei lactate dehydrogenase penta mutant with pyruvate
PDB Compounds: (E:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3vpfe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vpfe2 d.162.1.1 (E:151-318) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiakmvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrnkayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdafa

SCOPe Domain Coordinates for d3vpfe2:

Click to download the PDB-style file with coordinates for d3vpfe2.
(The format of our PDB-style files is described here.)

Timeline for d3vpfe2: