Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.7: Lysine biosynthesis enzyme LysX ATP-binding domain [103281] (2 proteins) automatically mapped to Pfam PF08443 automatically mapped to Pfam PF13535 |
Protein automated matches [227109] (1 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [226604] (1 PDB entry) |
Domain d3vpdb2: 3vpd B:89-281 [217982] Other proteins in same PDB: d3vpda1, d3vpdb1 automated match to d1uc8a2 complexed with anp, bua, cit |
PDB Entry: 3vpd (more details), 1.95 Å
SCOPe Domain Sequences for d3vpdb2:
Sequence, based on SEQRES records: (download)
>d3vpdb2 d.142.1.7 (B:89-281) automated matches {Thermus thermophilus [TaxId: 274]} kwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvigswgrllakvtdraaa eallehkevlggfqhqlfyiqeyvekpgrdirvfvvgeraiaaiyrrsahwitntarggq aencplteeiarlsvgaaeavgggvvavdlfesergllvnevnhtmefknsvhttgvdip geilryawevarg
>d3vpdb2 d.142.1.7 (B:89-281) automated matches {Thermus thermophilus [TaxId: 274]} kwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvigswgrllakvtdraaa eallehkevlggfqhqlfyiqeyvekpgrdirvfvvgeraiaaiyrqaencplteeiarl svgaaeavgggvvavdlfesergllvnevnhtmefknsvhttgvdipgeilryawevarg
Timeline for d3vpdb2: