SCOPe 2.06: Domain d3vpdb1: 3vpd B:1-88

Lineage for d3vpdb1 (3vpd B:1-88)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (35 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [226603] (4 PDB entries)

8. Domain d3vpdb1: 3vpd B:1-88 [217981]
   Other proteins in same PDB: d3vpda2, d3vpdb2
   automated match to d1uc8a1
   complexed with anp, bua, cit

Details for d3vpdb1

PDB Entry: 3vpd, 1.95 Å

PDB Description: LysX from Thermus thermophilus complexed with AMP-PNP

PDB Compounds: (B:) Ribosomal protein S6 modification protein

SCOPe Domain Sequences for d3vpdb1:

Sequence; same for both SEQRES and ATOM records:

>d3vpdb1 c.30.1.0 (B:1-88) automated matches {Thermus thermophilus [TaxId: 274]}
mlailydrirpdermlferaealglpykkvyvpalpmvlgerpealegvtvalercvsqs
rglaaaryltalgipvvnrpevieacgd

Timeline for d3vpdb1:

• d3vpdb1 first appeared in SCOPe 2.03
  
• d3vpdb1 appears in SCOPe 2.05
  
• d3vpdb1 appears in SCOPe 2.07
  
• d3vpdb1 appears in the current release, SCOPe 2.08