| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
| Protein automated matches [226903] (40 species) not a true protein |
| Species Thermus thermophilus [TaxId:274] [226603] (4 PDB entries) |
| Domain d3vpda1: 3vpd A:1-88 [217979] Other proteins in same PDB: d3vpda2, d3vpdb2 automated match to d1uc8a1 complexed with anp, bua, cit |
PDB Entry: 3vpd (more details), 1.95 Å
SCOPe Domain Sequences for d3vpda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vpda1 c.30.1.0 (A:1-88) automated matches {Thermus thermophilus [TaxId: 274]}
mlailydrirpdermlferaealglpykkvyvpalpmvlgerpealegvtvalercvsqs
rglaaaryltalgipvvnrpevieacgd
Timeline for d3vpda1: