Lineage for d3vpad2 (3vpa D:209-315)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1657767Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1657768Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1657769Protein Cell-division protein FtsZ [55309] (9 species)
  7. 1657825Species Staphylococcus aureus [TaxId:158878] [226456] (6 PDB entries)
  8. 1657832Domain d3vpad2: 3vpa D:209-315 [217978]
    Other proteins in same PDB: d3vpaa1, d3vpab1, d3vpac1, d3vpad1
    automated match to d1rq2a2

Details for d3vpad2

PDB Entry: 3vpa (more details), 2.49 Å

PDB Description: staphylococcus aureus ftsz apo-form
PDB Compounds: (D:) cell division protein ftsz

SCOPe Domain Sequences for d3vpad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vpad2 d.79.2.1 (D:209-315) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

SCOPe Domain Coordinates for d3vpad2:

Click to download the PDB-style file with coordinates for d3vpad2.
(The format of our PDB-style files is described here.)

Timeline for d3vpad2: