Lineage for d3vpac2 (3vpa C:209-315)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201405Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2201406Protein Cell-division protein FtsZ [55309] (9 species)
  7. 2201462Species Staphylococcus aureus [TaxId:158878] [226456] (6 PDB entries)
  8. 2201468Domain d3vpac2: 3vpa C:209-315 [217976]
    Other proteins in same PDB: d3vpaa1, d3vpab1, d3vpac1, d3vpad1, d3vpad3
    automated match to d1rq2a2

Details for d3vpac2

PDB Entry: 3vpa (more details), 2.49 Å

PDB Description: staphylococcus aureus ftsz apo-form
PDB Compounds: (C:) cell division protein ftsz

SCOPe Domain Sequences for d3vpac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vpac2 d.79.2.1 (C:209-315) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

SCOPe Domain Coordinates for d3vpac2:

Click to download the PDB-style file with coordinates for d3vpac2.
(The format of our PDB-style files is described here.)

Timeline for d3vpac2: