SCOPe 2.08: Domain d3voia1: 3voi A:76-433

Lineage for d3voia1 (3voi A:76-433)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families)

5. Family c.6.1.0: automated matches [195757] (1 protein)
   not a true family

6. Protein automated matches [195758] (2 species)
   not a true protein

7. Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [195759] (9 PDB entries)

8. Domain d3voia1: 3voi A:76-433 [217970]
   Other proteins in same PDB: d3voia2
   automated match to d3voha_
   complexed with mg, rcb

Details for d3voia1

PDB Entry: 3voi, 2 Å

PDB Description: CcCel6A catalytic domain complexed with p-nitrophenyl beta-D-cellotrioside

PDB Compounds: (A:) cellobiohydrolase

SCOPe Domain Sequences for d3voia1:

Sequence; same for both SEQRES and ATOM records:

>d3voia1 c.6.1.0 (A:76-433) automated matches {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
stgnpfegydiylspyyaeeveaaaamiddpvlkakalkvkeiptfiwfdvvrktpdlgr
yladataiqqrtgrkqlvqivvydlpdrdcaaaasngefsladggmekykdyvdrlasei
rkypdvrivaviepdslanmvtnmnvakcrgaeaaykegviyalrqlsalgvysyvdagh
agwlgwnanlapsarlfaqiykdagrsafirglatnvsnynalsattrdpvtqgndnyde
lrfinalapllrnegwdakfivdqgrsgvqnirqewgnwcnvygagfgmrptlntpssai
daivwikpggeadgtsdtsaprydthcgksdshkpapeagtwfqeyfvnlvknanppl

Timeline for d3voia1:

• d3voia1 first appeared in SCOPe 2.03, called d3voia_
  
• d3voia1 appears in SCOPe 2.07