SCOPe 2.05: Domain d3voga_: 3vog A:

Lineage for d3voga_ (3vog A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families)

5. Family c.6.1.0: automated matches [195757] (1 protein)
   not a true family

6. Protein automated matches [195758] (1 species)
   not a true protein

7. Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [195759] (8 PDB entries)

8. Domain d3voga_: 3vog A: [217969]
   automated match to d3voha_
   complexed with epe

Details for d3voga_

PDB Entry: 3vog, 1.45 Å

PDB Description: Catalytic domain of the cellobiohydrolase, CcCel6A, from Coprinopsis cinerea

PDB Compounds: (A:) cellobiohydrolase

SCOPe Domain Sequences for d3voga_:

Sequence; same for both SEQRES and ATOM records:

>d3voga_ c.6.1.0 (A:) automated matches {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
vpstgnpfegydiylspyyaeeveaaaamiddpvlkakalkvkeiptfiwfdvvrktpdl
gryladataiqqrtgrkqlvqivvydlpdrdcaaaasngefsladggmekykdyvdrlas
eirkypdvrivaviepdslanmvtnmnvakcrgaeaaykegviyalrqlsalgvysyvda
ghagwlgwnanlapsarlfaqiykdagrsafirglatnvsnynalsattrdpvtqgndny
delrfinalapllrnegwdakfivdqgrsgvqnirqewgnwcnvygagfgmrptlntpss
aidaivwikpggeadgtsdtsaprydthcgksdshkpapeagtwfqeyfvnlvknanppl
aa

Timeline for d3voga_:

• d3voga_ first appeared in SCOPe 2.03
  
• d3voga_ appears in SCOPe 2.04
  
• d3voga_ is called d3voga1 in SCOPe 2.06
  
• d3voga_ appears in the current release, SCOPe 2.08, called d3voga1