Lineage for d3voaa2 (3voa A:209-315)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959093Protein Cell-division protein FtsZ [55309] (9 species)
  7. 2959149Species Staphylococcus aureus [TaxId:158878] [226456] (6 PDB entries)
  8. 2959150Domain d3voaa2: 3voa A:209-315 [217966]
    Other proteins in same PDB: d3voaa1, d3voaa3
    automated match to d1rq2a2
    complexed with ca, gdp

    missing some secondary structures that made up less than one-third of the common domain

Details for d3voaa2

PDB Entry: 3voa (more details), 1.73 Å

PDB Description: Staphylococcus aureus FtsZ 12-316 GDP-form
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d3voaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3voaa2 d.79.2.1 (A:209-315) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

SCOPe Domain Coordinates for d3voaa2:

Click to download the PDB-style file with coordinates for d3voaa2.
(The format of our PDB-style files is described here.)

Timeline for d3voaa2: