SCOPe 2.08: Domain d3vo9c2: 3vo9 C:209-315

Lineage for d3vo9c2 (3vo9 C:209-315)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Cell-division protein FtsZ [55309] (9 species)

7. Species Staphylococcus aureus [TaxId:158878] [226456] (6 PDB entries)

8. Domain d3vo9c2: 3vo9 C:209-315 [217962]
   Other proteins in same PDB: d3vo9a1, d3vo9b1, d3vo9c1, d3vo9d1
   automated match to d1rq2a2
   missing some secondary structures that made up less than one-third of the common domain

Details for d3vo9c2

PDB Entry: 3vo9, 2.71 Å

PDB Description: Staphylococcus aureus FtsZ apo-form (SeMet)

PDB Compounds: (C:) cell division protein ftsz

SCOPe Domain Sequences for d3vo9c2:

Sequence; same for both SEQRES and ATOM records:

>d3vo9c2 d.79.2.1 (C:209-315) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

Timeline for d3vo9c2:

• d3vo9c2 first appeared in SCOPe 2.03
  
• d3vo9c2 appears in SCOPe 2.07