Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (27 proteins) |
Protein Killer cell inhibitory receptor [49202] (3 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries) |
Domain d1efxe2: 1efx E:104-200 [21796] Other proteins in same PDB: d1efxa1, d1efxa2, d1efxb_ |
PDB Entry: 1efx (more details), 3 Å
SCOP Domain Sequences for d1efxe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efxe2 b.1.1.4 (E:104-200) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3} lyekpslsaqpgptvlagesvtlscssrssydmyhlsregeahecrfsagpkvngtfqad fplgpathggtyrcfgsfrdspyewsnssdpllvsvi
Timeline for d1efxe2: