Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Cell-division protein FtsZ [55309] (9 species) |
Species Staphylococcus aureus [TaxId:158878] [226456] (6 PDB entries) |
Domain d3vo9a2: 3vo9 A:209-315 [217958] Other proteins in same PDB: d3vo9a1, d3vo9b1, d3vo9c1, d3vo9d1 automated match to d1rq2a2 |
PDB Entry: 3vo9 (more details), 2.71 Å
SCOPe Domain Sequences for d3vo9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vo9a2 d.79.2.1 (A:209-315) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]} ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf
Timeline for d3vo9a2: