SCOPe 2.03: Domain d3vo9a2: 3vo9 A:209-315

Lineage for d3vo9a2 (3vo9 A:209-315)

Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein Cell-division protein FtsZ [55309] (9 species)
Species Staphylococcus aureus [TaxId:158878] [226456] (6 PDB entries)
Domain d3vo9a2: 3vo9 A:209-315 [217958]
Other proteins in same PDB: d3vo9a1, d3vo9b1, d3vo9c1, d3vo9d1
automated match to d1rq2a2

Details for d3vo9a2

PDB Entry: 3vo9 (more details), 2.71 Å

PDB Description: Staphylococcus aureus FtsZ apo-form (SeMet)

PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d3vo9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vo9a2 d.79.2.1 (A:209-315) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

SCOPe Domain Coordinates for d3vo9a2:

Click to download the PDB-style file with coordinates for d3vo9a2.
(The format of our PDB-style files is described here.)

Timeline for d3vo9a2: