Lineage for d3vo8b2 (3vo8 B:209-315)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525408Protein Cell-division protein FtsZ [55309] (9 species)
  7. 2525464Species Staphylococcus aureus [TaxId:158878] [226456] (6 PDB entries)
  8. 2525467Domain d3vo8b2: 3vo8 B:209-315 [217956]
    Other proteins in same PDB: d3vo8a1, d3vo8b1
    automated match to d1rq2a2
    complexed with ca, gdp

Details for d3vo8b2

PDB Entry: 3vo8 (more details), 2.25 Å

PDB Description: Staphylococcus aureus FtsZ GDP-form
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d3vo8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vo8b2 d.79.2.1 (B:209-315) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

SCOPe Domain Coordinates for d3vo8b2:

Click to download the PDB-style file with coordinates for d3vo8b2.
(The format of our PDB-style files is described here.)

Timeline for d3vo8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vo8b1