Lineage for d3vo8a1 (3vo8 A:12-208)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471423Protein Cell-division protein FtsZ [52492] (9 species)
  7. 2471483Species Staphylococcus aureus [TaxId:158878] [226455] (7 PDB entries)
  8. 2471485Domain d3vo8a1: 3vo8 A:12-208 [217953]
    Other proteins in same PDB: d3vo8a2, d3vo8b2
    automated match to d1rq2a1
    complexed with ca, gdp

Details for d3vo8a1

PDB Entry: 3vo8 (more details), 2.25 Å

PDB Description: Staphylococcus aureus FtsZ GDP-form
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d3vo8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vo8a1 c.32.1.1 (A:12-208) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliavsgevn

SCOPe Domain Coordinates for d3vo8a1:

Click to download the PDB-style file with coordinates for d3vo8a1.
(The format of our PDB-style files is described here.)

Timeline for d3vo8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vo8a2