![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
![]() | Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
![]() | Protein automated matches [226871] (12 species) not a true protein |
![]() | Species Maize (Zea mays) [TaxId:4577] [226538] (5 PDB entries) |
![]() | Domain d3vo2b2: 3vo2 B:160-314 [217952] Other proteins in same PDB: d3vo2a1, d3vo2b1 automated match to d1qfza2 complexed with fad |
PDB Entry: 3vo2 (more details), 1.39 Å
SCOPe Domain Sequences for d3vo2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vo2b2 c.25.1.0 (B:160-314) automated matches {Maize (Zea mays) [TaxId: 4577]} dpnatvimlatgtgiapfrsflwkmfleehedykfsglawlflgvptsdsllykeelekm kemapdnfrldfavsreqtnaagekmyiqtrmaeyreelwellkkdntyvymcglkgmek giddimlnlaakdgidwmqykkqlkkgeqwnvevy
Timeline for d3vo2b2: