![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
![]() | Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
![]() | Protein automated matches [227029] (3 species) not a true protein |
![]() | Species Maize (Zea mays) [TaxId:4577] [225854] (1 PDB entry) |
![]() | Domain d3vo2b1: 3vo2 B:19-159 [217951] Other proteins in same PDB: d3vo2a1, d3vo2a2, d3vo2b2 automated match to d1qfza1 complexed with fad |
PDB Entry: 3vo2 (more details), 1.39 Å
SCOPe Domain Sequences for d3vo2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vo2b1 b.43.4.2 (B:19-159) automated matches {Maize (Zea mays) [TaxId: 4577]} tskkqdeglvtnkykpkepyvgrclsntritgddapgetwhmvfstegeipyregqsigi iadgedkngkphklrlysiassalgdfgdsktvslcvkrlvytndqgeivkgvcsnflcd lkpgadvkitgpvgkemlmpk
Timeline for d3vo2b1: