Lineage for d1efxe1 (1efx E:4-103)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031531Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2031764Protein Killer cell inhibitory receptor [49202] (4 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2031770Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries)
  8. 2031773Domain d1efxe1: 1efx E:4-103 [21795]
    Other proteins in same PDB: d1efxa1, d1efxa2, d1efxb2, d1efxb3

Details for d1efxe1

PDB Entry: 1efx (more details), 3 Å

PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3
PDB Compounds: (E:) natural killer cell receptor kir2dl2

SCOPe Domain Sequences for d1efxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efxe1 b.1.1.4 (E:4-103) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3 [TaxId: 9606]}
vhrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskan
fsigpmmqdlagtyrcygsvthspyqlsapsdpldivitg

SCOPe Domain Coordinates for d1efxe1:

Click to download the PDB-style file with coordinates for d1efxe1.
(The format of our PDB-style files is described here.)

Timeline for d1efxe1: