Lineage for d3vnha_ (3vnh A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326286Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1326961Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 1326962Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 1326971Protein automated matches [190126] (2 species)
    not a true protein
  7. 1326972Species Human (Homo sapiens) [TaxId:9606] [193097] (6 PDB entries)
  8. 1326977Domain d3vnha_: 3vnh A: [217944]
    automated match to d1zgka1
    complexed with fuu

Details for d3vnha_

PDB Entry: 3vnh (more details), 2.1 Å

PDB Description: Crystal Structure of Keap1 Soaked with Synthetic Small Molecular
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d3vnha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vnha_ b.68.11.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrn
nspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsve
ryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmit
amntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitv
hqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

SCOPe Domain Coordinates for d3vnha_:

Click to download the PDB-style file with coordinates for d3vnha_.
(The format of our PDB-style files is described here.)

Timeline for d3vnha_: