Lineage for d3vm5a2 (3vm5 A:405-499)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1328473Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1328474Protein automated matches [226835] (18 species)
    not a true protein
  7. 1328518Species Oryzias latipes [TaxId:8090] [226402] (1 PDB entry)
  8. 1328519Domain d3vm5a2: 3vm5 A:405-499 [217939]
    Other proteins in same PDB: d3vm5a1
    automated match to d3dhpa1
    complexed with ca, cl

Details for d3vm5a2

PDB Entry: 3vm5 (more details), 2.85 Å

PDB Description: Recombinant medaka fish alpha-amylase expressed in yeast Pichia pastoris
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d3vm5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vm5a2 b.71.1.0 (A:405-499) automated matches {Oryzias latipes [TaxId: 8090]}
qphanwwdngnnqvafgrgnrgfivfnnddwaldvtlntglpggtycdvisgnkdggsct
gkqitvggdgrahfyinnseedpfiaihadsklhh

SCOPe Domain Coordinates for d3vm5a2:

Click to download the PDB-style file with coordinates for d3vm5a2.
(The format of our PDB-style files is described here.)

Timeline for d3vm5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vm5a1