SCOPe 2.03: Domain d3vm5a2: 3vm5 A:405-499

Lineage for d3vm5a2 (3vm5 A:405-499)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (18 species)
   not a true protein

7. Species Oryzias latipes [TaxId:8090] [226402] (1 PDB entry)

8. Domain d3vm5a2: 3vm5 A:405-499 [217939]
   Other proteins in same PDB: d3vm5a1
   automated match to d3dhpa1
   complexed with ca, cl

Details for d3vm5a2

PDB Entry: 3vm5, 2.85 Å

PDB Description: Recombinant medaka fish alpha-amylase expressed in yeast Pichia pastoris

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d3vm5a2:

Sequence; same for both SEQRES and ATOM records:

>d3vm5a2 b.71.1.0 (A:405-499) automated matches {Oryzias latipes [TaxId: 8090]}
qphanwwdngnnqvafgrgnrgfivfnnddwaldvtlntglpggtycdvisgnkdggsct
gkqitvggdgrahfyinnseedpfiaihadsklhh

Timeline for d3vm5a2:

• d3vm5a2 is new in SCOPe 2.03-stable
  
• d3vm5a2 appears in SCOPe 2.04
  
• d3vm5a2 appears in the current release, SCOPe 2.08