SCOPe 2.04: Domain d3vllb1: 3vll B:18-423

Lineage for d3vllb1 (3vll B:18-423)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (9 species)
   not a true protein

7. Species Haloarcula marismortui [TaxId:272569] [226809] (7 PDB entries)

8. Domain d3vllb1: 3vll B:18-423 [217932]
   automated match to d1ub2a1
   complexed with hem, sha

Details for d3vllb1

PDB Entry: 3vll, 2 Å

PDB Description: crystal structure analysis of the ser305ala variant of katg from haloarcula marismortui complexes with inhibitor sha

PDB Compounds: (B:) Catalase-peroxidase 2

SCOPe Domain Sequences for d3vllb1:

Sequence; same for both SEQRES and ATOM records:

>d3vllb1 a.93.1.0 (B:18-423) automated matches {Haloarcula marismortui [TaxId: 272569]}
krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd
wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll
pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe
rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag
ghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskggemitagiegpwtqspte
wdmgyinnlldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkr
dpdyrevmetfqenpmefgmnfakawyklthrdmgpperflgpevp

Timeline for d3vllb1:

• d3vllb1 first appeared in SCOPe 2.03
  
• d3vllb1 appears in SCOPe 2.05
  
• d3vllb1 appears in the current release, SCOPe 2.08