![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.0: automated matches [191605] (1 protein) not a true family |
![]() | Protein automated matches [191104] (14 species) not a true protein |
![]() | Species Haloarcula marismortui [TaxId:272569] [226809] (7 PDB entries) |
![]() | Domain d3vllb1: 3vll B:18-423 [217932] automated match to d1ub2a1 complexed with hem, sha |
PDB Entry: 3vll (more details), 2 Å
SCOPe Domain Sequences for d3vllb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vllb1 a.93.1.0 (B:18-423) automated matches {Haloarcula marismortui [TaxId: 272569]} krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag ghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskggemitagiegpwtqspte wdmgyinnlldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkr dpdyrevmetfqenpmefgmnfakawyklthrdmgpperflgpevp
Timeline for d3vllb1: