Lineage for d3vlla2 (3vll A:424-731)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275305Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1275306Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1275879Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 1275880Protein automated matches [191104] (8 species)
    not a true protein
  7. 1275881Species Haloarcula marismortui [TaxId:272569] [226809] (7 PDB entries)
  8. 1275899Domain d3vlla2: 3vll A:424-731 [217931]
    automated match to d1ub2a2
    complexed with hem, sha

Details for d3vlla2

PDB Entry: 3vll (more details), 2 Å

PDB Description: crystal structure analysis of the ser305ala variant of katg from haloarcula marismortui complexes with inhibitor sha
PDB Compounds: (A:) Catalase-peroxidase 2

SCOPe Domain Sequences for d3vlla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vlla2 a.93.1.0 (A:424-731) automated matches {Haloarcula marismortui [TaxId: 272569]}
deemiwqdplpdadydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkrgga
ngarlrlepqknwevnepeqletvlgtleniqtefndsrsdgtqvsladlivlggnaave
qaaanagydveipfepgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevlvdn
adllnltaseltaliggmrsiganyqdtdlgvftdepetltndffvnlldmgtewepaad
sehrykgldrdtgevkweatridlifgsndrlraisevygsadaekklvhdfvdtwskvm
kldrfdle

SCOPe Domain Coordinates for d3vlla2:

Click to download the PDB-style file with coordinates for d3vlla2.
(The format of our PDB-style files is described here.)

Timeline for d3vlla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vlla1