SCOP 1.71: Domain d1efxd1: 1efx D:4-103

Lineage for d1efxd1 (1efx D:4-103)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.4: I set domains [49159] (34 proteins)
Protein Killer cell inhibitory receptor [49202] (4 species)
possibly an intermediate structure between the I set and FnIII domains
Species Human (Homo sapiens), kir2dl3 [TaxId:9606] [49203] (2 PDB entries)
Domain d1efxd1: 1efx D:4-103 [21793]
Other proteins in same PDB: d1efxa1, d1efxa2, d1efxb_

Details for d1efxd1

PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3

SCOP Domain Sequences for d1efxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efxd1 b.1.1.4 (D:4-103) Killer cell inhibitory receptor {Human (Homo sapiens), kir2dl3}
vhrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskan
fsigpmmqdlagtyrcygsvthspyqlsapsdpldivitg

SCOP Domain Coordinates for d1efxd1:

Click to download the PDB-style file with coordinates for d1efxd1.
(The format of our PDB-style files is described here.)

Timeline for d1efxd1: