Lineage for d3vlkb2 (3vlk B:424-731)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741311Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1741312Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1741936Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 1741937Protein automated matches [191104] (10 species)
    not a true protein
  7. 1741938Species Haloarcula marismortui [TaxId:272569] [226809] (7 PDB entries)
  8. 1741954Domain d3vlkb2: 3vlk B:424-731 [217929]
    automated match to d1ub2a2
    complexed with hem

Details for d3vlkb2

PDB Entry: 3vlk (more details), 2 Å

PDB Description: Crystal Structure Analysis of the Ser305Ala variant of KatG from Haloarcula marismortui
PDB Compounds: (B:) Catalase-peroxidase 2

SCOPe Domain Sequences for d3vlkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vlkb2 a.93.1.0 (B:424-731) automated matches {Haloarcula marismortui [TaxId: 272569]}
deemiwqdplpdadydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkrgga
ngarlrlepqknwevnepeqletvlgtleniqtefndsrsdgtqvsladlivlggnaave
qaaanagydveipfepgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevlvdn
adllnltaseltaliggmrsiganyqdtdlgvftdepetltndffvnlldmgtewepaad
sehrykgldrdtgevkweatridlifgsndrlraisevygsadaekklvhdfvdtwskvm
kldrfdle

SCOPe Domain Coordinates for d3vlkb2:

Click to download the PDB-style file with coordinates for d3vlkb2.
(The format of our PDB-style files is described here.)

Timeline for d3vlkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vlkb1