![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.0: automated matches [191605] (1 protein) not a true family |
![]() | Protein automated matches [191104] (14 species) not a true protein |
![]() | Species Haloarcula marismortui [TaxId:272569] [226809] (7 PDB entries) |
![]() | Domain d3vlkb2: 3vlk B:424-731 [217929] automated match to d1ub2a2 complexed with hem |
PDB Entry: 3vlk (more details), 2 Å
SCOPe Domain Sequences for d3vlkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vlkb2 a.93.1.0 (B:424-731) automated matches {Haloarcula marismortui [TaxId: 272569]} deemiwqdplpdadydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkrgga ngarlrlepqknwevnepeqletvlgtleniqtefndsrsdgtqvsladlivlggnaave qaaanagydveipfepgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevlvdn adllnltaseltaliggmrsiganyqdtdlgvftdepetltndffvnlldmgtewepaad sehrykgldrdtgevkweatridlifgsndrlraisevygsadaekklvhdfvdtwskvm kldrfdle
Timeline for d3vlkb2: