Lineage for d3vlkb1 (3vlk B:18-423)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720706Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2720707Protein automated matches [191104] (14 species)
    not a true protein
  7. 2720751Species Haloarcula marismortui [TaxId:272569] [226809] (7 PDB entries)
  8. 2720766Domain d3vlkb1: 3vlk B:18-423 [217928]
    automated match to d1ub2a1
    complexed with hem

Details for d3vlkb1

PDB Entry: 3vlk (more details), 2 Å

PDB Description: Crystal Structure Analysis of the Ser305Ala variant of KatG from Haloarcula marismortui
PDB Compounds: (B:) Catalase-peroxidase 2

SCOPe Domain Sequences for d3vlkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vlkb1 a.93.1.0 (B:18-423) automated matches {Haloarcula marismortui [TaxId: 272569]}
krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd
wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll
pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe
rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag
ghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskggemitagiegpwtqspte
wdmgyinnlldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkr
dpdyrevmetfqenpmefgmnfakawyklthrdmgpperflgpevp

SCOPe Domain Coordinates for d3vlkb1:

Click to download the PDB-style file with coordinates for d3vlkb1.
(The format of our PDB-style files is described here.)

Timeline for d3vlkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vlkb2