Lineage for d3vlja1 (3vlj A:18-423)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2003088Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2003089Protein automated matches [191104] (11 species)
    not a true protein
  7. 2003090Species Haloarcula marismortui [TaxId:272569] [226809] (7 PDB entries)
  8. 2003091Domain d3vlja1: 3vlj A:18-423 [217922]
    automated match to d1ub2a1
    complexed with cyn, ddj, hem

Details for d3vlja1

PDB Entry: 3vlj (more details), 1.7 Å

PDB Description: crystal structure analysis of the cyanide arg409leu variant complexes with o-dianisidine in katg from haloarcula marismortui
PDB Compounds: (A:) Catalase-peroxidase 2

SCOPe Domain Sequences for d3vlja1:

Sequence, based on SEQRES records: (download)

>d3vlja1 a.93.1.0 (A:18-423) automated matches {Haloarcula marismortui [TaxId: 272569]}
krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd
wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll
pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe
rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag
ghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskggemitsgiegpwtqspte
wdmgyinnlldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkr
dpdyrevmetfqenpmefgmnfakawyklthldmgpperflgpevp

Sequence, based on observed residues (ATOM records): (download)

>d3vlja1 a.93.1.0 (A:18-423) automated matches {Haloarcula marismortui [TaxId: 272569]}
krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd
wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll
pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe
rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag
ghtfgkvhgaddpeenlgpepeaapieqqglgwqnemitsgiegpwtqsptewdmgyinn
lldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkrdpdyrevm
etfqenpmefgmnfakawyklthldmgpperflgpevp

SCOPe Domain Coordinates for d3vlja1:

Click to download the PDB-style file with coordinates for d3vlja1.
(The format of our PDB-style files is described here.)

Timeline for d3vlja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vlja2