Lineage for d1f6aa2 (1f6a A:86-173)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54363Protein IgE high affinity receptor alpha subunit [49200] (1 species)
  7. 54364Species Human (Homo sapiens) [TaxId:9606] [49201] (6 PDB entries)
  8. 54382Domain d1f6aa2: 1f6a A:86-173 [21792]
    Other proteins in same PDB: d1f6ab1, d1f6ab2, d1f6ad1, d1f6ad2

Details for d1f6aa2

PDB Entry: 1f6a (more details), 3.5 Å

PDB Description: structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)

SCOP Domain Sequences for d1f6aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6aa2 b.1.1.4 (A:86-173) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhaisitnaaaed
sgtyyctgkvwqldyeseplnitvikap

SCOP Domain Coordinates for d1f6aa2:

Click to download the PDB-style file with coordinates for d1f6aa2.
(The format of our PDB-style files is described here.)

Timeline for d1f6aa2: