SCOP 1.55: Domain d1f6aa2: 1f6a A:86-173

Lineage for d1f6aa2 (1f6a A:86-173)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (21 proteins)

6. Protein IgE high affinity receptor alpha subunit [49200] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49201] (2 PDB entries)

8. Domain d1f6aa2: 1f6a A:86-173 [21792]
   Other proteins in same PDB: d1f6ab1, d1f6ab2, d1f6ad1, d1f6ad2

Details for d1f6aa2

PDB Entry: 1f6a, 3.5 Å

PDB Description: structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)

SCOP Domain Sequences for d1f6aa2:

Sequence; same for both SEQRES and ATOM records:

>d1f6aa2 b.1.1.4 (A:86-173) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhaisitnaaaed
sgtyyctgkvwqldyeseplnitvikap

Timeline for d1f6aa2:

• d1f6aa2 appears in SCOP 1.57
  
• d1f6aa2 appears in the current release, SCOPe 2.08