Lineage for d1f6aa1 (1f6a A:1-85)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 366356Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 366468Protein IgE high affinity receptor alpha subunit [49200] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 366469Species Human (Homo sapiens) [TaxId:9606] [49201] (6 PDB entries)
  8. 366486Domain d1f6aa1: 1f6a A:1-85 [21791]
    Other proteins in same PDB: d1f6ab1, d1f6ab2, d1f6ad1, d1f6ad2

Details for d1f6aa1

PDB Entry: 1f6a (more details), 3.5 Å

PDB Description: structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)

SCOP Domain Sequences for d1f6aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6aa1 b.1.1.4 (A:1-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
edsgeykcqhqqvaesepvylevfs

SCOP Domain Coordinates for d1f6aa1:

Click to download the PDB-style file with coordinates for d1f6aa1.
(The format of our PDB-style files is described here.)

Timeline for d1f6aa1: