![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (27 proteins) |
![]() | Protein IgE high affinity receptor alpha subunit [49200] (1 species) possibly an intermediate structure between the I set and FnIII domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49201] (6 PDB entries) |
![]() | Domain d1f6aa1: 1f6a A:1-85 [21791] Other proteins in same PDB: d1f6ab1, d1f6ab2, d1f6ad1, d1f6ad2 |
PDB Entry: 1f6a (more details), 3.5 Å
SCOP Domain Sequences for d1f6aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6aa1 b.1.1.4 (A:1-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens)} vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf edsgeykcqhqqvaesepvylevfs
Timeline for d1f6aa1:
![]() Domains from other chains: (mouse over for more information) d1f6ab1, d1f6ab2, d1f6ad1, d1f6ad2 |