Lineage for d3vl4a1 (3vl4 A:2-364)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905990Protein automated matches [190072] (22 species)
    not a true protein
  7. 2906093Species Shewanella oneidensis [TaxId:211586] [194175] (12 PDB entries)
  8. 2906100Domain d3vl4a1: 3vl4 A:2-364 [217909]
    Other proteins in same PDB: d3vl4a2
    automated match to d3vl3a_
    complexed with ca, cl, ipm

Details for d3vl4a1

PDB Entry: 3vl4 (more details), 1.88 Å

PDB Description: 3-isopropylmalate dehydrogenase from shewanella oneidensis mr-1 at 410 mpa
PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d3vl4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vl4a1 c.77.1.1 (A:2-364) automated matches {Shewanella oneidensis [TaxId: 211586]}
syqiavlagdgigpevmaearkvlkavearfglnieyteydvggiaidnhgcplpeatlk
gceaadailfgsvggpkweklppneqpergallplrghfelfcnlrpaklhdglehmspl
rsdisargfdvlcvreltggiyfgkpkgrqgegeseeafdtmrysrreisriariafeaa
rgrrkkvtsvdkanvlacsvlwrqvveevavdfpdvelehiyidnatmqllrrpdefdvm
lcsnlfgdilsdeiamltgsmgllssasmnstgfglfepaggsapdiagkgianpiaqil
saalmlrhslkqeeaasaieravtkalnsgyltgellssdqrhkakttvqmgdfiadavk
agv

SCOPe Domain Coordinates for d3vl4a1:

Click to download the PDB-style file with coordinates for d3vl4a1.
(The format of our PDB-style files is described here.)

Timeline for d3vl4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vl4a2