Lineage for d3vkxa1 (3vkx A:1-126)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1669824Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1669825Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1670010Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 1670032Protein Proliferating cell nuclear antigen (PCNA) [55989] (6 species)
  7. 1670068Species Human (Homo sapiens) [TaxId:9606] [55991] (9 PDB entries)
    Uniprot P12004
  8. 1670071Domain d3vkxa1: 3vkx A:1-126 [217905]
    automated match to d1u7ba1
    complexed with cl, so4, t3

Details for d3vkxa1

PDB Entry: 3vkx (more details), 2.1 Å

PDB Description: Structure of PCNA
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3vkxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vkxa1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

SCOPe Domain Coordinates for d3vkxa1:

Click to download the PDB-style file with coordinates for d3vkxa1.
(The format of our PDB-style files is described here.)

Timeline for d3vkxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vkxa2