| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
| Protein Proliferating cell nuclear antigen (PCNA) [55989] (6 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55991] (10 PDB entries) Uniprot P12004 |
| Domain d3vkxa1: 3vkx A:1-126 [217905] automated match to d1u7ba1 complexed with cl, so4, t3 |
PDB Entry: 3vkx (more details), 2.1 Å
SCOPe Domain Sequences for d3vkxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vkxa1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql
Timeline for d3vkxa1: