SCOPe 2.05: Domain d3vkvc2: 3vkv C:151-316

Lineage for d3vkvc2 (3vkv C:151-316)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (18 species)

7. Species Lactobacillus casei [TaxId:1582] [56345] (6 PDB entries)

8. Domain d3vkvc2: 3vkv C:151-316 [217898]
   Other proteins in same PDB: d3vkva1, d3vkvb1, d3vkvc1, d3vkvd1, d3vkve1, d3vkvf1
   automated match to d1llca2
   complexed with fbp, so4

Details for d3vkvc2

PDB Entry: 3vkv, 2.7 Å

PDB Description: complex structure of lactobacillus casei lactate dehydrogenase with fructose-1,6-bisphosphate

PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3vkvc2:

Sequence; same for both SEQRES and ATOM records:

>d3vkvc2 d.162.1.1 (C:151-316) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltda

Timeline for d3vkvc2:

• d3vkvc2 first appeared in SCOPe 2.03
  
• d3vkvc2 appears in SCOPe 2.04
  
• d3vkvc2 appears in SCOPe 2.06
  
• d3vkvc2 last appears in SCOPe 2.07