Lineage for d3vkue2 (3vku E:151-317)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1938743Protein Lactate dehydrogenase [56339] (18 species)
  7. 1938862Species Lactobacillus casei [TaxId:1582] [56345] (6 PDB entries)
  8. 1938867Domain d3vkue2: 3vku E:151-317 [217890]
    Other proteins in same PDB: d3vkua1, d3vkub1, d3vkuc1, d3vkud1, d3vkue1, d3vkuf1
    automated match to d1llca2
    complexed with so4; mutant

Details for d3vkue2

PDB Entry: 3vku (more details), 1.96 Å

PDB Description: penta mutant of lactobacillus casei lactate dehydrogenase
PDB Compounds: (E:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3vkue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vkue2 d.162.1.1 (E:151-317) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiakmvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrnkayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdaf

SCOPe Domain Coordinates for d3vkue2:

Click to download the PDB-style file with coordinates for d3vkue2.
(The format of our PDB-style files is described here.)

Timeline for d3vkue2: