SCOP 1.57: Domain d1f2qa1: 1f2q A:4-85

Lineage for d1f2qa1 (1f2q A:4-85)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (22 proteins)

6. Protein IgE high affinity receptor alpha subunit [49200] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49201] (6 PDB entries)

8. Domain d1f2qa1: 1f2q A:4-85 [21789]

Details for d1f2qa1

PDB Entry: 1f2q, 2.4 Å

PDB Description: crystal structure of the human high-affinity ige receptor

SCOP Domain Sequences for d1f2qa1:

Sequence, based on SEQRES records:

>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
kpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakfeds
geykcqhqqvnesepvylevfs

Sequence, based on observed residues (ATOM records):

>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
kpkvslnppwnrifkgenvtltcngnnfstkwfhngslseetnsslnivnakfedsgeyk
cqhqqvnesepvylevfs

Timeline for d1f2qa1:

• d1f2qa1 first appeared (with stable ids) in SCOP 1.55
  
• d1f2qa1 appears in SCOP 1.59
  
• d1f2qa1 appears in the current release, SCOPe 2.08