Lineage for d1f2qa1 (1f2q A:4-85)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54363Protein IgE high affinity receptor alpha subunit [49200] (1 species)
  7. 54364Species Human (Homo sapiens) [TaxId:9606] [49201] (6 PDB entries)
  8. 54365Domain d1f2qa1: 1f2q A:4-85 [21789]

Details for d1f2qa1

PDB Entry: 1f2q (more details), 2.4 Å

PDB Description: crystal structure of the human high-affinity ige receptor

SCOP Domain Sequences for d1f2qa1:

Sequence, based on SEQRES records: (download)

>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
kpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakfeds
geykcqhqqvnesepvylevfs

Sequence, based on observed residues (ATOM records): (download)

>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
kpkvslnppwnrifkgenvtltcngnnfstkwfhngslseetnsslnivnakfedsgeyk
cqhqqvnesepvylevfs

SCOP Domain Coordinates for d1f2qa1:

Click to download the PDB-style file with coordinates for d1f2qa1.
(The format of our PDB-style files is described here.)

Timeline for d1f2qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f2qa2