SCOPe 2.06: Domain d3vk9a2: 3vk9 A:87-214

Lineage for d3vk9a2 (3vk9 A:87-214)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (61 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (8 PDB entries)

8. Domain d3vk9a2: 3vk9 A:87-214 [217874]
   Other proteins in same PDB: d3vk9a1, d3vk9b1, d3vk9c1, d3vk9d1
   automated match to d1r5aa1
   complexed with gol

Details for d3vk9a2

PDB Entry: 3vk9, 2 Å

PDB Description: Crystal structure of delta-class glutathione transferase from silkmoth

PDB Compounds: (A:) Glutathione S-transferase delta

SCOPe Domain Sequences for d3vk9a2:

Sequence; same for both SEQRES and ATOM records:

>d3vk9a2 a.45.1.0 (A:87-214) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
edpkaralvdqrlyfdigtlyqrfsdyfypqvfagapadkaknekvqealqlldkflegq
kyvagpnltvadlsliasvssleasdidfkkyanvkrwyetvkstapgyqeanekgleaf
kglvnsml

Timeline for d3vk9a2:

• d3vk9a2 first appeared in SCOPe 2.03
  
• d3vk9a2 appears in SCOPe 2.05
  
• d3vk9a2 appears in SCOPe 2.07
  
• d3vk9a2 appears in the current release, SCOPe 2.08