Lineage for d1e4kc1 (1e4k C:1-86)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9408Family b.1.1.4: I set domains [49159] (21 proteins)
  6. 9415Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
  7. 9422Species Human (Homo sapiens), III [TaxId:9606] [49199] (3 PDB entries)
  8. 9427Domain d1e4kc1: 1e4k C:1-86 [21787]
    Other proteins in same PDB: d1e4ka1, d1e4ka2, d1e4kb1, d1e4kb2

Details for d1e4kc1

PDB Entry: 1e4k (more details), 3.2 Å

PDB Description: crystal structure of soluble human igg1 fc fragment-fc-gamma receptor iii complex

SCOP Domain Sequences for d1e4kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4kc1 b.1.1.4 (C:1-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III}
dlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatv
ndsgeyrcqtnlstlsdpvqlevhig

SCOP Domain Coordinates for d1e4kc1:

Click to download the PDB-style file with coordinates for d1e4kc1.
(The format of our PDB-style files is described here.)

Timeline for d1e4kc1: