Lineage for d3vj9a_ (3vj9 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731599Family a.128.1.2: Squalene synthase [48580] (2 proteins)
    automatically mapped to Pfam PF00494
  6. 2731605Protein automated matches [191305] (1 species)
    not a true protein
  7. 2731606Species Human (Homo sapiens) [TaxId:9606] [190011] (24 PDB entries)
  8. 2731608Domain d3vj9a_: 3vj9 A: [217852]
    automated match to d3vjca_
    complexed with ca, ni

Details for d3vj9a_

PDB Entry: 3vj9 (more details), 1.52 Å

PDB Description: Crystal structure of the human squalene synthase
PDB Compounds: (A:) Squalene synthase

SCOPe Domain Sequences for d3vj9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vj9a_ a.128.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkv
pllhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigm
aefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqkt
niirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvi
tylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatnmpav
kaiiyqymeeiyhripdsdpsssktrqiistirtq

SCOPe Domain Coordinates for d3vj9a_:

Click to download the PDB-style file with coordinates for d3vj9a_.
(The format of our PDB-style files is described here.)

Timeline for d3vj9a_: