SCOPe 2.07: Domain d3vi7a1: 3vi7 A:2-75

Lineage for d3vi7a1 (3vi7 A:2-75)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class sigma GST [81362] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89705] (15 PDB entries)
   Uniprot O60760
   synonym: hematopoietic prostaglandin D synthase

8. Domain d3vi7a1: 3vi7 A:2-75 [217836]
   Other proteins in same PDB: d3vi7a2, d3vi7b2, d3vi7c2, d3vi7d2
   automated match to d1iyha2
   complexed with ca, cbd, gsh

Details for d3vi7a1

PDB Entry: 3vi7, 2 Å

PDB Description: Human hematopoietic prostaglandin D synthase inhibitor complex structures

PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d3vi7a1:

Sequence; same for both SEQRES and ATOM records:

>d3vi7a1 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

Timeline for d3vi7a1:

• d3vi7a1 first appeared in SCOPe 2.03
  
• d3vi7a1 appears in SCOPe 2.06
  
• d3vi7a1 appears in the current release, SCOPe 2.08