Lineage for d3vi5b2 (3vi5 B:276-399)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1270996Protein Class sigma GST [81351] (5 species)
  7. 1271009Species Human (Homo sapiens) [TaxId:9606] [89061] (13 PDB entries)
    Uniprot O60760; synonym: hematopoietic prostaglandin D synthase
  8. 1271039Domain d3vi5b2: 3vi5 B:276-399 [217831]
    Other proteins in same PDB: d3vi5a1, d3vi5b1, d3vi5c1, d3vi5d1
    automated match to d1iyha1
    complexed with ca, gol, gsh, m4m

Details for d3vi5b2

PDB Entry: 3vi5 (more details), 2 Å

PDB Description: Human hematopoietic prostaglandin D synthase inhibitor complex structures
PDB Compounds: (B:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d3vi5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vi5b2 a.45.1.1 (B:276-399) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d3vi5b2:

Click to download the PDB-style file with coordinates for d3vi5b2.
(The format of our PDB-style files is described here.)

Timeline for d3vi5b2: