SCOPe 2.08: Domain d3vi3l1: 3vi3 L:1-112

Lineage for d3vi3l1 (3vi3 L:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3vi3l1: 3vi3 L:1-112 [217826]
   Other proteins in same PDB: d3vi3a1, d3vi3a2, d3vi3c1, d3vi3c2, d3vi3e2, d3vi3f_, d3vi3h_, d3vi3l2
   automated match to d1dqdl1
   complexed with ca, mg, nag

Details for d3vi3l1

PDB Entry: 3vi3, 2.9 Å

PDB Description: crystal structure of alpha5beta1 integrin headpiece (ligand-free form)

PDB Compounds: (L:) SG/19 Fab fragment (Light chain)

SCOPe Domain Sequences for d3vi3l1:

Sequence; same for both SEQRES and ATOM records:

>d3vi3l1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqatpsipvtpgesvsiscrsnksllhsngntylywflqrpgqsprllifrmsnla
sgvpdrfsgsgsgtaftlrisrveaadvgiyfclqhleypftfgagtklelk

Timeline for d3vi3l1:

• d3vi3l1 first appeared in SCOPe 2.03
  
• d3vi3l1 appears in SCOPe 2.07