SCOPe 2.05: Domain d3vhxe_: 3vhx E:

Lineage for d3vhxe_ (3vhx E:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [225429] (3 PDB entries)

8. Domain d3vhxe_: 3vhx E: [217822]
   automated match to d1upta_
   complexed with gol, gtp, mg

Details for d3vhxe_

PDB Entry: 3vhx, 2.81 Å

PDB Description: The crystal structure of Arf6-MKLP1 (Mitotic kinesin-like protein 1) complex

PDB Compounds: (E:) ADP-ribosylation factor 6

SCOPe Domain Sequences for d3vhxe_:

Sequence; same for both SEQRES and ATOM records:

>d3vhxe_ c.37.1.8 (E:) ADP-ribosylation factor {Mouse (Mus musculus) [TaxId: 10090]}
memrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsny

Timeline for d3vhxe_:

• d3vhxe_ first appeared in SCOPe 2.03
  
• d3vhxe_ appears in SCOPe 2.04
  
• d3vhxe_ is called d3vhxe1 in SCOPe 2.06
  
• d3vhxe_ appears in the current release, SCOPe 2.08, called d3vhxe1