Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein ADP-ribosylation factor [52614] (16 species) |
Species Mouse (Mus musculus) [TaxId:10090] [225429] (3 PDB entries) |
Domain d3vhxe_: 3vhx E: [217822] automated match to d1upta_ complexed with gol, gtp, mg |
PDB Entry: 3vhx (more details), 2.81 Å
SCOPe Domain Sequences for d3vhxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vhxe_ c.37.1.8 (E:) ADP-ribosylation factor {Mouse (Mus musculus) [TaxId: 10090]} memrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsny
Timeline for d3vhxe_: