Lineage for d3vhxe1 (3vhx E:13-173)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866676Protein ADP-ribosylation factor [52614] (17 species)
  7. 2866740Species Mouse (Mus musculus) [TaxId:10090] [225429] (3 PDB entries)
  8. 2866744Domain d3vhxe1: 3vhx E:13-173 [217822]
    Other proteins in same PDB: d3vhxa2, d3vhxc2, d3vhxe2, d3vhxg2
    automated match to d1upta_
    complexed with gol, gtp, mg

Details for d3vhxe1

PDB Entry: 3vhx (more details), 2.81 Å

PDB Description: The crystal structure of Arf6-MKLP1 (Mitotic kinesin-like protein 1) complex
PDB Compounds: (E:) ADP-ribosylation factor 6

SCOPe Domain Sequences for d3vhxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vhxe1 c.37.1.8 (E:13-173) ADP-ribosylation factor {Mouse (Mus musculus) [TaxId: 10090]}
emrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkirp
lwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamkp
heiqeklgltrirdrnwyvqpscatsgdglyegltwltsny

SCOPe Domain Coordinates for d3vhxe1:

Click to download the PDB-style file with coordinates for d3vhxe1.
(The format of our PDB-style files is described here.)

Timeline for d3vhxe1: